(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE367

CP000435.PE367       Location/Qualifiers
FT   CDS             380117..382120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0374"
FT                   /product="ribonuclease, Rne/Rng family protein"
FT                   /note="identified by match to protein family HMM PF00575;
FT                   match to protein family HMM TIGR00757"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46252"
FT                   /db_xref="GOA:Q0ID66"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID66"
FT                   /protein_id="ABI46252.1"
FT                   /translation="MPQQIVIAEQLRIAAVLTDECVDELIVAQGRYQIGDVYLGTVENV
FT                   LPGIDAAFVNIGESEKNGFIHVTDLGPLRLKKGAAGITELLEPRQKVLVQVMKEPTGTK
FT                   GPRLTGNLALPGRYLVLQPSGQGVNISRRIGSEGERNRLRALGVLVKPPGAGLLIRTEA
FT                   DGISEELLIDDLESLLRQWEAIQKASEAASPPVLLNRDEDFIHRILRDHTGLDLDRVVV
FT                   ESPAAVERVRSFLGDEGSHVVVEAHPEPSELLEDYKVNGAIRDALKPRVDLPSGGYVII
FT                   EPTEALTVIDVNSGSFTRSANARETVLWTNCEAAIEIARQLRLRNIGGVIIVDFIDMDS
FT                   RRDQLQLLEHFTGAIRDDAARPQIAQLTELGLVELTRKRQGQNIYELFGRACPSCGGLG
FT                   HVAVLPGKDLMQPLATATGLVRSAASARAEVPQAGEASNARRRRGGRGKVISASGPADR
FT                   GDAPLEEVESATGAATSAAIEPASVSRRQDPELVAVPMDEDEEQVYGWLGLNPALLLDS
FT                   QPELDNLMVRIVRPGEDPEQVLEQARQQMSANSGRRRRRGPRGNGRSAGTGTGRSAASG
FT                   SGDESAPTTPVAPLDRDDPSQPLLVEIVPLIETPVPVMSPEPLAVSVAEPVSVSISEPV
FT                   VSSEPEVTAEPADTSESRPGRRRRRSSASTSE"
     MPQQIVIAEQ LRIAAVLTDE CVDELIVAQG RYQIGDVYLG TVENVLPGID AAFVNIGESE        60
     KNGFIHVTDL GPLRLKKGAA GITELLEPRQ KVLVQVMKEP TGTKGPRLTG NLALPGRYLV       120
     LQPSGQGVNI SRRIGSEGER NRLRALGVLV KPPGAGLLIR TEADGISEEL LIDDLESLLR       180
     QWEAIQKASE AASPPVLLNR DEDFIHRILR DHTGLDLDRV VVESPAAVER VRSFLGDEGS       240
     HVVVEAHPEP SELLEDYKVN GAIRDALKPR VDLPSGGYVI IEPTEALTVI DVNSGSFTRS       300
     ANARETVLWT NCEAAIEIAR QLRLRNIGGV IIVDFIDMDS RRDQLQLLEH FTGAIRDDAA       360
     RPQIAQLTEL GLVELTRKRQ GQNIYELFGR ACPSCGGLGH VAVLPGKDLM QPLATATGLV       420
     RSAASARAEV PQAGEASNAR RRRGGRGKVI SASGPADRGD APLEEVESAT GAATSAAIEP       480
     ASVSRRQDPE LVAVPMDEDE EQVYGWLGLN PALLLDSQPE LDNLMVRIVR PGEDPEQVLE       540
     QARQQMSANS GRRRRRGPRG NGRSAGTGTG RSAASGSGDE SAPTTPVAPL DRDDPSQPLL       600
     VEIVPLIETP VPVMSPEPLA VSVAEPVSVS ISEPVVSSEP EVTAEPADTS ESRPGRRRRR       660
     SSASTSE                                                                 667
//

If you have problems or comments...

PBIL Back to PBIL home page