(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE370

CP000435.PE370       Location/Qualifiers
FT   CDS             383329..384168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0377"
FT                   /product="prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="identified by match to protein family HMM PF00800;
FT                   match to protein family HMM PF01842"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47165"
FT                   /db_xref="GOA:Q0ID63"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID63"
FT                   /protein_id="ABI47165.1"
FT                   /translation="MPMRVAFLGPEGTYGERAARSLMRLEAIENPELVACLGLRSVVEH
FT                   VADGRCESAVVPVENSVEGGVTAILDALWSYSNLRIRRAVVLPIRHALLSSGTLDGISE
FT                   VLSHPQALAQCSGWLARHLPQAVQLPASSTAEAARMVRGSHFRAAIADRSLAGQQGLQE
FT                   LAYPVNDVAGNRTRFLLLQNGEVSREGDVASLALSLHQNTPGALIEALEVIAQLGLNMS
FT                   RIESRPSKRELGEYVFFVDVELPGKETSELLEQLTTSLQPLCEHLLHFGAYPSSVLE"
     MPMRVAFLGP EGTYGERAAR SLMRLEAIEN PELVACLGLR SVVEHVADGR CESAVVPVEN        60
     SVEGGVTAIL DALWSYSNLR IRRAVVLPIR HALLSSGTLD GISEVLSHPQ ALAQCSGWLA       120
     RHLPQAVQLP ASSTAEAARM VRGSHFRAAI ADRSLAGQQG LQELAYPVND VAGNRTRFLL       180
     LQNGEVSREG DVASLALSLH QNTPGALIEA LEVIAQLGLN MSRIESRPSK RELGEYVFFV       240
     DVELPGKETS ELLEQLTTSL QPLCEHLLHF GAYPSSVLE                              279
//

If you have problems or comments...

PBIL Back to PBIL home page