(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE371

CP000435.PE371       Location/Qualifiers
FT   CDS             complement(384200..385144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0378"
FT                   /product="cyclopropane-fatty-acyl-phospholipid synthase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF02353"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47237"
FT                   /db_xref="GOA:Q0ID62"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR025774"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID62"
FT                   /protein_id="ABI47237.1"
FT                   /translation="MPSPTVLIPTAAGLLLLGCAYQLWNRRNRAYHSSESVAAAYDAWT
FT                   DDQLLESLWGEHVHLGHYGSPPQPRDFRQAKSDFVHELVHWSGFDQLPPGSRVLDVGCG
FT                   IGGSARILSRDYGLDVLGISISPAQVNRATHLTPDSLPCRFAVMDALNLQLEDQSFDAV
FT                   WTVEAGPHMPDKQRFANELLRVLKPGGRLAVADWNRRDPVDGALNRRERWVMHQLLTQW
FT                   AHPEFASIRGFRQNLENSPHHRGTISTDDWTDATLPSWNESILEGIRRPNAILRLGPKA
FT                   VLQGLRETPTLLLMRWAFARGMMQFGVFKTNHC"
     MPSPTVLIPT AAGLLLLGCA YQLWNRRNRA YHSSESVAAA YDAWTDDQLL ESLWGEHVHL        60
     GHYGSPPQPR DFRQAKSDFV HELVHWSGFD QLPPGSRVLD VGCGIGGSAR ILSRDYGLDV       120
     LGISISPAQV NRATHLTPDS LPCRFAVMDA LNLQLEDQSF DAVWTVEAGP HMPDKQRFAN       180
     ELLRVLKPGG RLAVADWNRR DPVDGALNRR ERWVMHQLLT QWAHPEFASI RGFRQNLENS       240
     PHHRGTISTD DWTDATLPSW NESILEGIRR PNAILRLGPK AVLQGLRETP TLLLMRWAFA       300
     RGMMQFGVFK TNHC                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page