(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE372

CP000435.PE372       Location/Qualifiers
FT   CDS             complement(385144..385806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0379"
FT                   /product="ATP-dependent protease La"
FT                   /EC_number="3.4.21.53"
FT                   /note="identified by match to protein family HMM PF02190"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45107"
FT                   /db_xref="GOA:Q0ID61"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID61"
FT                   /protein_id="ABI45107.1"
FT                   /translation="MVDLSVRELPLFPLPDVVLFPSDVLPLHIFESRYRMMLQSVLETD
FT                   RRFGVVRWDPNQQTMAAVGCCAEVIQHQTGDDGRSNIVTLGQQRFRVLNVTREMPFRSA
FT                   MVSWIEDEPVDNTSELESLAATVTQALKDVVELTGKLTDSKSSLPDDLPDLPRELSFWI
FT                   GAHLGGPVADQQQDLLELTSTRTRLEQEFEMLDETRRQLAARTVLRDTLTETDPSNG"
     MVDLSVRELP LFPLPDVVLF PSDVLPLHIF ESRYRMMLQS VLETDRRFGV VRWDPNQQTM        60
     AAVGCCAEVI QHQTGDDGRS NIVTLGQQRF RVLNVTREMP FRSAMVSWIE DEPVDNTSEL       120
     ESLAATVTQA LKDVVELTGK LTDSKSSLPD DLPDLPRELS FWIGAHLGGP VADQQQDLLE       180
     LTSTRTRLEQ EFEMLDETRR QLAARTVLRD TLTETDPSNG                             220
//

If you have problems or comments...

PBIL Back to PBIL home page