(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE378

CP000435.PE378       Location/Qualifiers
FT   CDS             complement(390705..391031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0385"
FT                   /product="Uncharacterized HesB family conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45254"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID55"
FT                   /protein_id="ABI45254.1"
FT                   /translation="MGATFSISASAAAELGRQAAIAGTPGLMHLDLVSGSCEQHVIRLR
FT                   PGHLAGIAMARADGVTLHAPEEQLHLLEGLCLDYRGDLSGGGFLISPQDNVRCCLCGSA
FT                   FSRC"
     MGATFSISAS AAAELGRQAA IAGTPGLMHL DLVSGSCEQH VIRLRPGHLA GIAMARADGV        60
     TLHAPEEQLH LLEGLCLDYR GDLSGGGFLI SPQDNVRCCL CGSAFSRC                    108
//

If you have problems or comments...

PBIL Back to PBIL home page