(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE380

CP000435.PE380       Location/Qualifiers
FT   CDS             392797..397479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0387"
FT                   /product="Ferredoxin-dependent glutamate synthase,
FT                   Fd-GOGAT"
FT                   /EC_number="1.4.7.1"
FT                   /note="identified by match to protein family HMM PF00310;
FT                   match to protein family HMM PF00478; match to protein
FT                   family HMM PF01493; match to protein family HMM PF01645;
FT                   match to protein family HMM PF04898"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45120"
FT                   /db_xref="GOA:Q0ID53"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID53"
FT                   /protein_id="ABI45120.1"
FT                   /translation="MGESLGSEIAQPATECERRCCCTSRLQVMTQLTGSDWPYCDSSAP
FT                   AAVAGEKDACGVGFLAQLQGERSYWVLQQALRGLGCMEHRGGCGGDGDSGDGAGVLCEI
FT                   PWDYLRAIWPEAANGNGLGMMFLPKDPSLRAEVQRFCDQEAQSLGLMSIGWREVPIDSA
FT                   VLGPLARETAPVIQQWLVQRDVDADALESLLLRLRRRVGARVRKEFGAEGAREFYVASL
FT                   SGRTVVYKGMVRSEVLAQYYADLRDPRFAVSFAVYHRRFSTNTLPRWPLAQPMRLLGHN
FT                   GEINTLLGNLNWAKASEAGLEDVWGDAAADLIPVVNPDFSDSANLDATLELMVRSGRSI
FT                   TDSLITLVPEAFRNQPDLESRPDVTAMYEFNAGIQEPWDGPALLVFADGKRVGATLDRN
FT                   GLRPARWCTTADGFVIMGSETGVVDLSGKTVVEKGRLGPGQMVAVDLERGELLTNWAVK
FT                   EDAAQRFPYGDWLKQHRRSVSAQPWTQDCQISELDLLRLQTAMGFTAEDLDLVIEDMAG
FT                   LGKEPTYCMGDDIPLAVLSDKPHLLYDYFKQRFAQVTNPPIDPLREKLVMSLEMHLGQR
FT                   RPAVKPQAAAAALIHLDTPVLNEAELSALSDQGLAVRSLSTQVAVEACAGGLQSAVDAL
FT                   CLKAEDAVRKGAQVLVLSDRVNAEEQPAELMATTVAMPALLAVGAVHHHLLRQKLRLHC
FT                   SLVSETAQCWSTHHMACLIGYGASAVCPWLTWETTRHWLAHPKTQKRIEQGKLQPLDAN
FT                   KAQANVRLSLENGLRKILSKIGISLLASYHGAQIFEAIGLGADVIQKAFAGTTSRVAGM
FT                   TLLELANETLSLHAKAFPELNRSKLEFMGFVQYRTGGEYHLNSPEMSKALHSAVKAGPG
FT                   YDHFSTYKTLLENRPVTALRDLLEFKLAATPLPLDQVESAESLCTRFCTGGMSLGALSR
FT                   EAHEVLAVAMNRIGGKSNSGEGGEDPIRFQILKDVDGDGRSSSFPSIGGLRNGDTACSA
FT                   IKQIASGRFGVTAEYLRSGKQLEIKVAQGAKPGEGGQLPGPKVDEYIAGLRNSKAGVAL
FT                   ISPPPHHDIYSIEDLAQLIHDLHQVHPKAPVSVKLVAEIGIGTIAAGVAKANADVIQIS
FT                   GHDGGTGASPLSSIKHAGSPWELGLTEVHRSLLENGLRDRVLLRADGGLKTGWDVVVAA
FT                   LLGAEEYGFGSVAMIAEGCIMARVCHTNNCPVGVATQKAALRKRFTGVPEHVVNFFWYV
FT                   AEEVRQLMSVLGVARLEDLIGRSDLLQPRSVELEKTKCVDLSSLLAPVGDANDRSWLKH
FT                   SSEAHGNGPILEDHLLADADFMDAVENHGSLSRTIEIVNTDRSVGARFAGEIAQRHGNR
FT                   GFKGQLNLNFRGAAGQSFAAFLVQGMTMRLEGEANDYVGKGMNSGRISLVPDDGVANPG
FT                   DQVILGNTCLYGATGGELFANGRAGERFGVRNSGARAVVEGAGDHCCEYMTGGVIVVLG
FT                   GTGRNVGAGMTGGVAFLLDEAGGVKARVNPEIVEVVGITTPQQESLLKSLLEAHVSTTS
FT                   SEKAKALLADWTNAKSSFKLLVPPSERAAMGLEAREVVAA"
     MGESLGSEIA QPATECERRC CCTSRLQVMT QLTGSDWPYC DSSAPAAVAG EKDACGVGFL        60
     AQLQGERSYW VLQQALRGLG CMEHRGGCGG DGDSGDGAGV LCEIPWDYLR AIWPEAANGN       120
     GLGMMFLPKD PSLRAEVQRF CDQEAQSLGL MSIGWREVPI DSAVLGPLAR ETAPVIQQWL       180
     VQRDVDADAL ESLLLRLRRR VGARVRKEFG AEGAREFYVA SLSGRTVVYK GMVRSEVLAQ       240
     YYADLRDPRF AVSFAVYHRR FSTNTLPRWP LAQPMRLLGH NGEINTLLGN LNWAKASEAG       300
     LEDVWGDAAA DLIPVVNPDF SDSANLDATL ELMVRSGRSI TDSLITLVPE AFRNQPDLES       360
     RPDVTAMYEF NAGIQEPWDG PALLVFADGK RVGATLDRNG LRPARWCTTA DGFVIMGSET       420
     GVVDLSGKTV VEKGRLGPGQ MVAVDLERGE LLTNWAVKED AAQRFPYGDW LKQHRRSVSA       480
     QPWTQDCQIS ELDLLRLQTA MGFTAEDLDL VIEDMAGLGK EPTYCMGDDI PLAVLSDKPH       540
     LLYDYFKQRF AQVTNPPIDP LREKLVMSLE MHLGQRRPAV KPQAAAAALI HLDTPVLNEA       600
     ELSALSDQGL AVRSLSTQVA VEACAGGLQS AVDALCLKAE DAVRKGAQVL VLSDRVNAEE       660
     QPAELMATTV AMPALLAVGA VHHHLLRQKL RLHCSLVSET AQCWSTHHMA CLIGYGASAV       720
     CPWLTWETTR HWLAHPKTQK RIEQGKLQPL DANKAQANVR LSLENGLRKI LSKIGISLLA       780
     SYHGAQIFEA IGLGADVIQK AFAGTTSRVA GMTLLELANE TLSLHAKAFP ELNRSKLEFM       840
     GFVQYRTGGE YHLNSPEMSK ALHSAVKAGP GYDHFSTYKT LLENRPVTAL RDLLEFKLAA       900
     TPLPLDQVES AESLCTRFCT GGMSLGALSR EAHEVLAVAM NRIGGKSNSG EGGEDPIRFQ       960
     ILKDVDGDGR SSSFPSIGGL RNGDTACSAI KQIASGRFGV TAEYLRSGKQ LEIKVAQGAK      1020
     PGEGGQLPGP KVDEYIAGLR NSKAGVALIS PPPHHDIYSI EDLAQLIHDL HQVHPKAPVS      1080
     VKLVAEIGIG TIAAGVAKAN ADVIQISGHD GGTGASPLSS IKHAGSPWEL GLTEVHRSLL      1140
     ENGLRDRVLL RADGGLKTGW DVVVAALLGA EEYGFGSVAM IAEGCIMARV CHTNNCPVGV      1200
     ATQKAALRKR FTGVPEHVVN FFWYVAEEVR QLMSVLGVAR LEDLIGRSDL LQPRSVELEK      1260
     TKCVDLSSLL APVGDANDRS WLKHSSEAHG NGPILEDHLL ADADFMDAVE NHGSLSRTIE      1320
     IVNTDRSVGA RFAGEIAQRH GNRGFKGQLN LNFRGAAGQS FAAFLVQGMT MRLEGEANDY      1380
     VGKGMNSGRI SLVPDDGVAN PGDQVILGNT CLYGATGGEL FANGRAGERF GVRNSGARAV      1440
     VEGAGDHCCE YMTGGVIVVL GGTGRNVGAG MTGGVAFLLD EAGGVKARVN PEIVEVVGIT      1500
     TPQQESLLKS LLEAHVSTTS SEKAKALLAD WTNAKSSFKL LVPPSERAAM GLEAREVVAA      1560
//

If you have problems or comments...

PBIL Back to PBIL home page