(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE381

CP000435.PE381       Location/Qualifiers
FT   CDS             397495..397803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0388"
FT                   /product="uncharacterized ycii family conserved protein"
FT                   /note="identified by match to protein family HMM PF03795"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45760"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID52"
FT                   /protein_id="ABI45760.1"
FT                   /translation="MPWFIKQETFTDAMTSLSAEERRIHCNDHRRWVEAQRRAGLAMAS
FT                   GFLVDDQHKPGGGGLLVFEAESFEAAKAFIAADPMISRNLVDWTLHEWKPVEGSLQA"
     MPWFIKQETF TDAMTSLSAE ERRIHCNDHR RWVEAQRRAG LAMASGFLVD DQHKPGGGGL        60
     LVFEAESFEA AKAFIAADPM ISRNLVDWTL HEWKPVEGSL QA                          102
//

If you have problems or comments...

PBIL Back to PBIL home page