(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE388

CP000435.PE388       Location/Qualifiers
FT   CDS             complement(408306..409505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0396"
FT                   /product="possible fatty acid desaturase"
FT                   /note="identified by match to protein family HMM PF00487"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46894"
FT                   /db_xref="GOA:Q0ID45"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID45"
FT                   /protein_id="ABI46894.1"
FT                   /translation="MQQKRDRFTHQADRGTPRGSCMTTTTQTISQDMAPSAYPKRIDFK
FT                   LAPFMASDDRIASWQILNTVVPIIAVAIAMSAVTTSFNTTAIVLTPLLLVLMVLLLSRS
FT                   FSLMHDCGHQSLFSSKRSNRIAAFGLSLIHGMPQHPWSRGHAFHHKHNGNWDRYRGPSA
FT                   LITREQYEARSPRSQWLYRVLRHPLLLFPGGFFYLIIKPRLALLLSFFEFIGHSIKSTI
FT                   KMVRTGSWISPKHVCLNYKSSFFYTSGECVDMVANTAVVGLLWWWIGSSIGYAHFWILY
FT                   SVVMSCSAAVMIAVFFIQHNFPDSYTSDEDNWSYFRGAISGSSFLQMPAVLNWFTADIA
FT                   YHHIHHLSERIPNYRLKECHEANIHLVDNVHKLYLYQIGDCFSLILWDRERFKLVSPFA
FT                   "
     MQQKRDRFTH QADRGTPRGS CMTTTTQTIS QDMAPSAYPK RIDFKLAPFM ASDDRIASWQ        60
     ILNTVVPIIA VAIAMSAVTT SFNTTAIVLT PLLLVLMVLL LSRSFSLMHD CGHQSLFSSK       120
     RSNRIAAFGL SLIHGMPQHP WSRGHAFHHK HNGNWDRYRG PSALITREQY EARSPRSQWL       180
     YRVLRHPLLL FPGGFFYLII KPRLALLLSF FEFIGHSIKS TIKMVRTGSW ISPKHVCLNY       240
     KSSFFYTSGE CVDMVANTAV VGLLWWWIGS SIGYAHFWIL YSVVMSCSAA VMIAVFFIQH       300
     NFPDSYTSDE DNWSYFRGAI SGSSFLQMPA VLNWFTADIA YHHIHHLSER IPNYRLKECH       360
     EANIHLVDNV HKLYLYQIGD CFSLILWDRE RFKLVSPFA                              399
//

If you have problems or comments...

PBIL Back to PBIL home page