(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE393

CP000435.PE393       Location/Qualifiers
FT   CDS             complement(413967..414971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0401"
FT                   /product="Glycosyl transferase, family 2"
FT                   /EC_number="2.-.-.-"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46925"
FT                   /db_xref="GOA:Q0ID40"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID40"
FT                   /protein_id="ABI46925.1"
FT                   /translation="MSLSPAAPSNASANEESSLDVSVVVPLYNEEESLPELVEQLLSSL
FT                   RPSGERFELVLVNDGSSDQTAAVLQQVSQEVPELVGVLLRKNYGQTAAMAAGFDVARGR
FT                   IIVSLDGDLQNDPADIPLLLAKLREGYDLVSGWRHQRQDAELQRKLPSRIANRLIGKVT
FT                   GVKLHDYGCSLKAYDRAVLSDMRLYGELHRFLPALAFIEGARITEVKVNHRARQYGSSK
FT                   YGIDRTFRVLMDLLTVWFMKRFLTRPMYVFGFAGLIAIALSLISSSYLLMIKLQGADIG
FT                   NRPLLTLAVVLGLAGIQLFCFGLLAELLIRTYHESQGRPIYRIRATLRGGRTG"
     MSLSPAAPSN ASANEESSLD VSVVVPLYNE EESLPELVEQ LLSSLRPSGE RFELVLVNDG        60
     SSDQTAAVLQ QVSQEVPELV GVLLRKNYGQ TAAMAAGFDV ARGRIIVSLD GDLQNDPADI       120
     PLLLAKLREG YDLVSGWRHQ RQDAELQRKL PSRIANRLIG KVTGVKLHDY GCSLKAYDRA       180
     VLSDMRLYGE LHRFLPALAF IEGARITEVK VNHRARQYGS SKYGIDRTFR VLMDLLTVWF       240
     MKRFLTRPMY VFGFAGLIAI ALSLISSSYL LMIKLQGADI GNRPLLTLAV VLGLAGIQLF       300
     CFGLLAELLI RTYHESQGRP IYRIRATLRG GRTG                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page