(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE398

CP000435.PE398       Location/Qualifiers
FT   CDS             418698..419198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0407"
FT                   /product="HNH endonuclease family protein"
FT                   /EC_number="3.1.21.-"
FT                   /note="identified by match to protein family HMM PF01844"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45782"
FT                   /db_xref="GOA:Q0ID35"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR029471"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID35"
FT                   /protein_id="ABI45782.1"
FT                   /translation="MGQVLVLNASYEPLNITTWRRAMVMLMKGKAEGLEHDQSKLIRQG
FT                   THLPTVIRLVQFVRVPFRQLPLTRRNVFQRDNHCCQYCGSRTEQLSIDHVMPRSRGGGD
FT                   SWDNITTACLSCNVRKGSRTPEEAGMPLNRVPRRPHSSLSFEAVRQIDSGRYLEWAKYV
FT                   IGA"
     MGQVLVLNAS YEPLNITTWR RAMVMLMKGK AEGLEHDQSK LIRQGTHLPT VIRLVQFVRV        60
     PFRQLPLTRR NVFQRDNHCC QYCGSRTEQL SIDHVMPRSR GGGDSWDNIT TACLSCNVRK       120
     GSRTPEEAGM PLNRVPRRPH SSLSFEAVRQ IDSGRYLEWA KYVIGA                      166
//

If you have problems or comments...

PBIL Back to PBIL home page