(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE430

CP000435.PE430       Location/Qualifiers
FT   CDS             436607..437680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0439"
FT                   /product="Fe-S cluster containing protein"
FT                   /note="identified by match to protein family HMM PF00037"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46995"
FT                   /db_xref="InterPro:IPR013283"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR021039"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID03"
FT                   /protein_id="ABI46995.1"
FT                   /translation="MATLEGAFEQLNLTVKAALQRADAGELALGNGSWVKLICGASNQD
FT                   SATIGDLCALFAVAGVHCVDVAADIAVVRAAREGLDWAWEHTRRRPWLMVSVSDGNDAH
FT                   FRKAVFDPGLCPPDCSRPCERVCPADAIRAAVGVDEQLCYGCGRCWPACPSQLIQSMDR
FT                   RVGLNDLASLLHNLRPDALEIHTAPGRLNAFQATLEQVRLANVPLRRLSVSCGLEGHHV
FT                   TVESLSKELWQRHQALRAFQQRPLWQLDGRPMSGDLGVGTAHAAVGLWQRLHPLAPPGP
FT                   LQLAGGTNTATLGLLPREGRAIGPAGVAFGGVARTLVQPFFQAAQDRGCRLRDWPDGWA
FT                   QSLRAARALIAPWLRRS"
     MATLEGAFEQ LNLTVKAALQ RADAGELALG NGSWVKLICG ASNQDSATIG DLCALFAVAG        60
     VHCVDVAADI AVVRAAREGL DWAWEHTRRR PWLMVSVSDG NDAHFRKAVF DPGLCPPDCS       120
     RPCERVCPAD AIRAAVGVDE QLCYGCGRCW PACPSQLIQS MDRRVGLNDL ASLLHNLRPD       180
     ALEIHTAPGR LNAFQATLEQ VRLANVPLRR LSVSCGLEGH HVTVESLSKE LWQRHQALRA       240
     FQQRPLWQLD GRPMSGDLGV GTAHAAVGLW QRLHPLAPPG PLQLAGGTNT ATLGLLPREG       300
     RAIGPAGVAF GGVARTLVQP FFQAAQDRGC RLRDWPDGWA QSLRAARALI APWLRRS          357
//

If you have problems or comments...

PBIL Back to PBIL home page