(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE431

CP000435.PE431       Location/Qualifiers
FT   CDS             437747..439393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0440"
FT                   /product="R3H domain protein"
FT                   /note="identified by match to protein family HMM PF01424"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47302"
FT                   /db_xref="GOA:Q0ID02"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034081"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID02"
FT                   /protein_id="ABI47302.1"
FT                   /translation="MTTERITDDLNRLVSLLPAELQSSLASTESRDQLLEVVLDLGRVP
FT                   EARYSGWSTALGSTSVTHADLQAMVERLGQFGSDNRAGIERTLHRISAIRNRRGEVVGL
FT                   TCRVGRAVFGTVAMVRDLLDSGESLLLMGRPGVGKTTALREIARVLADDLGKRVVVIDT
FT                   SNEIAGDGDIPHPAIGRARRMQVARPELQHQVMIEAVENHMPEVIVIDEIGTELEARAA
FT                   RTIAERGVTLVATAHGNALSNLIKNPTLCDLIGGIESVTLGDDEARRRRSQKTVLERAA
FT                   EPTFSMAVEMHSRSRWAVYREVGRAVDALLRGQLPSPEERKMASDGRVLRVEPQLSTSP
FT                   LRRPSLAPVPLPSPLDPIPLQPVGMGGSTQSELKPSQAPSKMFQVLCCGLSEQRLDEAV
FT                   RRHDWSIQAVDDLVQADVVLSVRQGLGRQPELRRQAREAGVPILVIKSDTLPQVERALE
FT                   RLLMRRDSGLPHRDSADSGDGDGDQSDASAALEECRLAIEQVVVPQGRPVELLPRTEEV
FT                   RQMQSDLVTRYRLRSDVYGTSGQRRLRVFPP"
     MTTERITDDL NRLVSLLPAE LQSSLASTES RDQLLEVVLD LGRVPEARYS GWSTALGSTS        60
     VTHADLQAMV ERLGQFGSDN RAGIERTLHR ISAIRNRRGE VVGLTCRVGR AVFGTVAMVR       120
     DLLDSGESLL LMGRPGVGKT TALREIARVL ADDLGKRVVV IDTSNEIAGD GDIPHPAIGR       180
     ARRMQVARPE LQHQVMIEAV ENHMPEVIVI DEIGTELEAR AARTIAERGV TLVATAHGNA       240
     LSNLIKNPTL CDLIGGIESV TLGDDEARRR RSQKTVLERA AEPTFSMAVE MHSRSRWAVY       300
     REVGRAVDAL LRGQLPSPEE RKMASDGRVL RVEPQLSTSP LRRPSLAPVP LPSPLDPIPL       360
     QPVGMGGSTQ SELKPSQAPS KMFQVLCCGL SEQRLDEAVR RHDWSIQAVD DLVQADVVLS       420
     VRQGLGRQPE LRRQAREAGV PILVIKSDTL PQVERALERL LMRRDSGLPH RDSADSGDGD       480
     GDQSDASAAL EECRLAIEQV VVPQGRPVEL LPRTEEVRQM QSDLVTRYRL RSDVYGTSGQ       540
     RRLRVFPP                                                                548
//

If you have problems or comments...

PBIL Back to PBIL home page