(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE444

CP000435.PE444       Location/Qualifiers
FT   CDS             450636..451463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0454"
FT                   /product="PP-loop family protein"
FT                   /note="identified by match to protein family HMM PF00733;
FT                   match to protein family HMM TIGR00268"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46050"
FT                   /db_xref="GOA:Q0ICY9"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR005232"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICY9"
FT                   /protein_id="ABI46050.1"
FT                   /translation="MFRQLESLSELEHDVLKRLRDSLASQQQVCVAYSGGVDSSLVAAI
FT                   AHEQLGEQALAITGVSPSLAPHLLLEARQQAAWLGMRHQEVLTLELEDPDYTSNPQDRC
FT                   YACKRELHRHLAPIAAEANGALVLDGVNQDDLGDHRPGIAAAKEAGVRSPLAELGITKA
FT                   TVRRLSWALGFPWWDKPAQPCLASRFPYGDSISRERLQRVGQAEAWLIQQGFDQVRVRS
FT                   HGLAARVEVPEERITDLLQPWLRRELVKSLLGFGFTSVSVDVEGLVSGKLNRV"
     MFRQLESLSE LEHDVLKRLR DSLASQQQVC VAYSGGVDSS LVAAIAHEQL GEQALAITGV        60
     SPSLAPHLLL EARQQAAWLG MRHQEVLTLE LEDPDYTSNP QDRCYACKRE LHRHLAPIAA       120
     EANGALVLDG VNQDDLGDHR PGIAAAKEAG VRSPLAELGI TKATVRRLSW ALGFPWWDKP       180
     AQPCLASRFP YGDSISRERL QRVGQAEAWL IQQGFDQVRV RSHGLAARVE VPEERITDLL       240
     QPWLRRELVK SLLGFGFTSV SVDVEGLVSG KLNRV                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page