(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE450

CP000435.PE450       Location/Qualifiers
FT   CDS             complement(458240..459385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0461"
FT                   /product="putative glutamate--cysteine ligase"
FT                   /note="identified by match to protein family HMM PF04107;
FT                   match to protein family HMM TIGR02048"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47790"
FT                   /db_xref="GOA:Q0ICY3"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011792"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICY3"
FT                   /protein_id="ABI47790.1"
FT                   /translation="MIQKLRLKGFEVELFTGRSSGENVGVAELVKQDLTEFCVEPDHRN
FT                   LEYITNPESDYGKLKEALLAPRRRLRTWLAERNLTLLPGSTLTLGDATQFERSNPNDPY
FT                   HDLIEATYGTTVVTASIHINLGISEPADLFAALRLVRCEAALLLALSASSPFLNRQITG
FT                   AHSQRWLQFPLTPKQVPLFRDLEHFVEWTDTQLMEGRMHNVRHLWTSVRPNGPQRPFDL
FT                   NRLELRICDLVTNPDLLLAITALMELRVLMLLREPNQLDPFKASDLSADQLMVLSDTND
FT                   ATAARHSLDAQLRDWRDGRQRLCRNWLRDMINDVMPLAHELELTSYLLPLESVLAEGNQ
FT                   AMRWLKGIENGRSLEEEFRTGILEMEQEEQPIDRSLADALG"
     MIQKLRLKGF EVELFTGRSS GENVGVAELV KQDLTEFCVE PDHRNLEYIT NPESDYGKLK        60
     EALLAPRRRL RTWLAERNLT LLPGSTLTLG DATQFERSNP NDPYHDLIEA TYGTTVVTAS       120
     IHINLGISEP ADLFAALRLV RCEAALLLAL SASSPFLNRQ ITGAHSQRWL QFPLTPKQVP       180
     LFRDLEHFVE WTDTQLMEGR MHNVRHLWTS VRPNGPQRPF DLNRLELRIC DLVTNPDLLL       240
     AITALMELRV LMLLREPNQL DPFKASDLSA DQLMVLSDTN DATAARHSLD AQLRDWRDGR       300
     QRLCRNWLRD MINDVMPLAH ELELTSYLLP LESVLAEGNQ AMRWLKGIEN GRSLEEEFRT       360
     GILEMEQEEQ PIDRSLADAL G                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page