(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE451

CP000435.PE451       Location/Qualifiers
FT   CDS             complement(459382..460914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0462"
FT                   /product="putative anthranilate synthase component I"
FT                   /note="identified by similarity to SP:P20579; match to
FT                   protein family HMM PF00425; match to protein family HMM
FT                   PF04715"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47155"
FT                   /db_xref="GOA:Q0ICY2"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICY2"
FT                   /protein_id="ABI47155.1"
FT                   /translation="MLSPDRSAFLEAARCGATFIPVAHSWPADLETPLTTWLKVGEGHP
FT                   PGVLLESVEGGENLGRWSVIACDPLWTLSARGDVLTRRWRDGYEESFQGNPLEVLRECT
FT                   NAYRPVSLPGLPPLGQLYGMWGYELIRWIEPSVPVHKADENAPPDGVWMLMDSILIIDQ
FT                   VKRLITAVAYGDLSNTRAAAKSADQAWDGAMGRILGLENRMASPLPQVRPLRWKPAARP
FT                   TPETESNRSPENYQEAVATAQEHIAAGDAFQLVISQRLETRVSQPPLEVYRSLRMVNPS
FT                   PYMAFFDFGDWYLIGSSPEVMVKAEPDQGGIRASLRPIAGTRPRGRNELEDRNFEVDLL
FT                   ADPKERAEHVMLVDLGRNDLGRVCTAGTVDVKELMVIERYSHVMHIVSQVEGRLAQGRD
FT                   IWDLLMASFPAGTVSGAPKIRAMQLIHQLEPDARGPYSGVYGSVDLAGALNTAITIRTM
FT                   VVRPHPEGGWNIQVQAGAGVVADSDPASEYQETLNKARAMLTALACLEDPKS"
     MLSPDRSAFL EAARCGATFI PVAHSWPADL ETPLTTWLKV GEGHPPGVLL ESVEGGENLG        60
     RWSVIACDPL WTLSARGDVL TRRWRDGYEE SFQGNPLEVL RECTNAYRPV SLPGLPPLGQ       120
     LYGMWGYELI RWIEPSVPVH KADENAPPDG VWMLMDSILI IDQVKRLITA VAYGDLSNTR       180
     AAAKSADQAW DGAMGRILGL ENRMASPLPQ VRPLRWKPAA RPTPETESNR SPENYQEAVA       240
     TAQEHIAAGD AFQLVISQRL ETRVSQPPLE VYRSLRMVNP SPYMAFFDFG DWYLIGSSPE       300
     VMVKAEPDQG GIRASLRPIA GTRPRGRNEL EDRNFEVDLL ADPKERAEHV MLVDLGRNDL       360
     GRVCTAGTVD VKELMVIERY SHVMHIVSQV EGRLAQGRDI WDLLMASFPA GTVSGAPKIR       420
     AMQLIHQLEP DARGPYSGVY GSVDLAGALN TAITIRTMVV RPHPEGGWNI QVQAGAGVVA       480
     DSDPASEYQE TLNKARAMLT ALACLEDPKS                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page