(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE459

CP000435.PE459       Location/Qualifiers
FT   CDS             complement(467878..468261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0470"
FT                   /product="possible Pex protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45684"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICX4"
FT                   /protein_id="ABI45684.1"
FT                   /translation="MLHRRNATQNCLADIEHYFQQPPPLFLDLELAVCWIVDCLLQHDS
FT                   YPSGLLQRLQREHPQLRVSETVLHQAVDFLNQQELLDCYSKRCPSRGRPRRMLHLHEEA
FT                   RAEAERLMEPWHRWLHEHEPMTT"
     MLHRRNATQN CLADIEHYFQ QPPPLFLDLE LAVCWIVDCL LQHDSYPSGL LQRLQREHPQ        60
     LRVSETVLHQ AVDFLNQQEL LDCYSKRCPS RGRPRRMLHL HEEARAEAER LMEPWHRWLH       120
     EHEPMTT                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page