(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE460

CP000435.PE460       Location/Qualifiers
FT   CDS             468387..469031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0471"
FT                   /product="3'-5' exonuclease family protein"
FT                   /note="identified by match to protein family HMM PF01612"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47566"
FT                   /db_xref="GOA:Q0ICX3"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICX3"
FT                   /protein_id="ABI47566.1"
FT                   /translation="MTDISAQPRAFAVFDGDLDADWAERYSHATALAVDTEAMGLIHGR
FT                   DRLCLVQICDAEDQVSCVRIALGQTEAPRLKELMERASIEKVFHFARFDVAALATGLGI
FT                   RVNPIFCTKVGSRLARTYSPRHGLKEVVMELVGVELDKQAQSSDWGRVDELSETQLAYA
FT                   ANDARYLLPARDRLKEMLQREGRWELAERCFECIPVMSDLDRFRFNQTFEH"
     MTDISAQPRA FAVFDGDLDA DWAERYSHAT ALAVDTEAMG LIHGRDRLCL VQICDAEDQV        60
     SCVRIALGQT EAPRLKELME RASIEKVFHF ARFDVAALAT GLGIRVNPIF CTKVGSRLAR       120
     TYSPRHGLKE VVMELVGVEL DKQAQSSDWG RVDELSETQL AYAANDARYL LPARDRLKEM       180
     LQREGRWELA ERCFECIPVM SDLDRFRFNQ TFEH                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page