(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE468

CP000435.PE468       Location/Qualifiers
FT   CDS             complement(473797..474423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0480"
FT                   /product="possible Hpt domain"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46336"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICW5"
FT                   /protein_id="ABI46336.1"
FT                   /translation="MAFDRIQRTTRRRSSAGPTPPRRPLGGSYDRASGHRQGPRPTFLA
FT                   LKDHGKVFVADMPFLSDGQLANITKEASEVLESLERRIVELEEIADQPIADRDTLIKAC
FT                   TKRDVTHRFLRAIEDEQQQRRENPAVLSAAGESLPRTFLEIARHRLPGATFDSLLQEAL
FT                   NACEQSKAQEESSNPSPVKVIPFQGKPSSLPVVVSPDPDPADQAL"
     MAFDRIQRTT RRRSSAGPTP PRRPLGGSYD RASGHRQGPR PTFLALKDHG KVFVADMPFL        60
     SDGQLANITK EASEVLESLE RRIVELEEIA DQPIADRDTL IKACTKRDVT HRFLRAIEDE       120
     QQQRRENPAV LSAAGESLPR TFLEIARHRL PGATFDSLLQ EALNACEQSK AQEESSNPSP       180
     VKVIPFQGKP SSLPVVVSPD PDPADQAL                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page