(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE47

CP000435.PE47        Location/Qualifiers
FT   CDS             50173..50553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0048"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46411"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE36"
FT                   /protein_id="ABI46411.1"
FT                   /translation="MEIRVTLKQGGSVLPMPVEEVVERFLKTKRARIREEWEGKDAAGR
FT                   RSITKERYALIEGKLRNYLVPFLGAKTDARNVPFSKWNEWEGWRVESRHTRTGGKPKAI
FT                   TIQNEMGGKRFLLSGVLMRNPD"
     MEIRVTLKQG GSVLPMPVEE VVERFLKTKR ARIREEWEGK DAAGRRSITK ERYALIEGKL        60
     RNYLVPFLGA KTDARNVPFS KWNEWEGWRV ESRHTRTGGK PKAITIQNEM GGKRFLLSGV       120
     LMRNPD                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page