(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE479

CP000435.PE479       Location/Qualifiers
FT   CDS             complement(482611..483357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0491"
FT                   /product="15,16-dihydrobiliverdin:ferredoxin
FT                   oxidoreductase"
FT                   /EC_number="1.3.7.2"
FT                   /note="identified by match to protein family HMM PF05996"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46433"
FT                   /db_xref="GOA:Q0ICV4"
FT                   /db_xref="InterPro:IPR009249"
FT                   /db_xref="InterPro:IPR023658"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICV4"
FT                   /protein_id="ABI46433.1"
FT                   /translation="MLRLILCKDIYTMFDSFLNELHSDITKRGGSALPLPEGLEECRSL
FT                   KTSSVIKSWLWDVPGFRRWRVTRLDAGDSLQVFNSVAYPDYNYDHPLMGVDLLWFGARQ
FT                   KLVAVLDFQPLIQDKDYLDRYFYGLKDLNQRFPDLNSEETMRSFDPNQYFSSWLLFCRG
FT                   GAEQADVSLPNAFSAFLKAYWELHDNAKSIASTIPPEEVKNLQEKYDIYSAERDPAHGL
FT                   FTSHFGKDWSNRFLHEFLFPASSPNK"
     MLRLILCKDI YTMFDSFLNE LHSDITKRGG SALPLPEGLE ECRSLKTSSV IKSWLWDVPG        60
     FRRWRVTRLD AGDSLQVFNS VAYPDYNYDH PLMGVDLLWF GARQKLVAVL DFQPLIQDKD       120
     YLDRYFYGLK DLNQRFPDLN SEETMRSFDP NQYFSSWLLF CRGGAEQADV SLPNAFSAFL       180
     KAYWELHDNA KSIASTIPPE EVKNLQEKYD IYSAERDPAH GLFTSHFGKD WSNRFLHEFL       240
     FPASSPNK                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page