(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE485

CP000435.PE485       Location/Qualifiers
FT   CDS             complement(485735..486640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0497"
FT                   /product="Bilin biosynthesis protein mpeV"
FT                   /note="identified by match to protein family HMM PF03130"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47613"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICU8"
FT                   /protein_id="ABI47613.1"
FT                   /translation="MTESNPIKNSSDSQRLNKLSEEEALVLSEHLKEQRNSGIPLDSDQ
FT                   KSISRMVAGLGDPRGLLRLRFADSLGSVGQAAVPALCDAMLSSDNVTVRRAAAKTLTLI
FT                   EDPNSLPDLVCAFLNDQDSVVQGSAMGAMAAIGEEAVTPILNLLSNPETSEMQIGLANW
FT                   ALAFIGDRGSRTLKDASSSSNSTIRKAAIAALTSRIDTLNEDENKHLLSNASKDDDSEI
FT                   RAEVATLLGAMEDVDWAKPLLISNLDDPDSWVRKNSALSLIKLNAKEAIAPLEERETQE
FT                   EDKIVANVIKLAIQKLKQID"
     MTESNPIKNS SDSQRLNKLS EEEALVLSEH LKEQRNSGIP LDSDQKSISR MVAGLGDPRG        60
     LLRLRFADSL GSVGQAAVPA LCDAMLSSDN VTVRRAAAKT LTLIEDPNSL PDLVCAFLND       120
     QDSVVQGSAM GAMAAIGEEA VTPILNLLSN PETSEMQIGL ANWALAFIGD RGSRTLKDAS       180
     SSSNSTIRKA AIAALTSRID TLNEDENKHL LSNASKDDDS EIRAEVATLL GAMEDVDWAK       240
     PLLISNLDDP DSWVRKNSAL SLIKLNAKEA IAPLEERETQ EEDKIVANVI KLAIQKLKQI       300
     D                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page