(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE487

CP000435.PE487       Location/Qualifiers
FT   CDS             487619..488947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0499"
FT                   /product="Bilin biosynthesis protein cpeY"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45513"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICU6"
FT                   /protein_id="ABI45513.1"
FT                   /translation="MHTSARFDNIHPGLTCEHARQLLMKSVNEQESESDFYTAAAHLIN
FT                   CPCEETQKALIEFLQYRDSSCQSVKITKRKIVEVLARLGCIDAIPAIGKCLWSDDIYLV
FT                   ENTVWSLQTLKCQDRVFVDKIIDILEADVANQRIIIQFLASMGISSSVDIIRSFQSNSI
FT                   PGIKGAAISAIAKLTHDCERVPEISSNLLLPNQMDRHSAIQDLIDANAVDQIAEIFSAP
FT                   VSPVFKLRAVRKLYDENLAESVDSCLLSSLDSLLSCDLSSINCVHRYDEVPSCEYLIRD
FT                   LYNTDFSRCYLALEHLSSHSASEIFPLLKNSWIEEANNDYGAHYCFICLFGSIPVWPGE
FT                   FEPWIIDILVSSIFNIRPQFQKSRAASVLSLAKLHPGILDECMEEILATRGSLPWDMRY
FT                   SLIQAMDHYTDLDMASKSKMILEISDDDKDLFVQARARMALGL"
     MHTSARFDNI HPGLTCEHAR QLLMKSVNEQ ESESDFYTAA AHLINCPCEE TQKALIEFLQ        60
     YRDSSCQSVK ITKRKIVEVL ARLGCIDAIP AIGKCLWSDD IYLVENTVWS LQTLKCQDRV       120
     FVDKIIDILE ADVANQRIII QFLASMGISS SVDIIRSFQS NSIPGIKGAA ISAIAKLTHD       180
     CERVPEISSN LLLPNQMDRH SAIQDLIDAN AVDQIAEIFS APVSPVFKLR AVRKLYDENL       240
     AESVDSCLLS SLDSLLSCDL SSINCVHRYD EVPSCEYLIR DLYNTDFSRC YLALEHLSSH       300
     SASEIFPLLK NSWIEEANND YGAHYCFICL FGSIPVWPGE FEPWIIDILV SSIFNIRPQF       360
     QKSRAASVLS LAKLHPGILD ECMEEILATR GSLPWDMRYS LIQAMDHYTD LDMASKSKMI       420
     LEISDDDKDL FVQARARMAL GL                                                442
//

If you have problems or comments...

PBIL Back to PBIL home page