(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE488

CP000435.PE488       Location/Qualifiers
FT   CDS             488981..489652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0500"
FT                   /product="Bilin biosynthesis protein cpeZ"
FT                   /note="identified by match to protein family HMM PF02985"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46258"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICU5"
FT                   /protein_id="ABI46258.1"
FT                   /translation="MLLSPAKIVKSSSCVVSSIISLDDLFLDLSHPNPNIRMDACVLMS
FT                   ENYYDEALPRLLDLLNDPDPVVYRTAVKGLGVFGHRVLPPLLDLFNGTSNCTVKACCIK
FT                   AFVQVAVNFPDNAFPEQAINALKLALEDSNPVVSQSALMTLGYFSKQEHEKGRVIPILI
FT                   QVCNSANIAHVQSAVMSLAEVESTQVDQCFASMINNDSTDVLIKEILESSISRRQSLFG
FT                   D"
     MLLSPAKIVK SSSCVVSSII SLDDLFLDLS HPNPNIRMDA CVLMSENYYD EALPRLLDLL        60
     NDPDPVVYRT AVKGLGVFGH RVLPPLLDLF NGTSNCTVKA CCIKAFVQVA VNFPDNAFPE       120
     QAINALKLAL EDSNPVVSQS ALMTLGYFSK QEHEKGRVIP ILIQVCNSAN IAHVQSAVMS       180
     LAEVESTQVD QCFASMINND STDVLIKEIL ESSISRRQSL FGD                         223
//

If you have problems or comments...

PBIL Back to PBIL home page