(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE495

CP000435.PE495       Location/Qualifiers
FT   CDS             494479..494799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46360"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICT8"
FT                   /protein_id="ABI46360.1"
FT                   /translation="MTVSIEAEKALPRFVQLISQNIDLQDRLNSVTDINSLRSLIQSVE
FT                   PLLTGAALIPLEQATRPPKILVDSGHTSQKIPWRLLRCTGGPLVLQLICMNSNFAIWIE
FT                   SC"
     MTVSIEAEKA LPRFVQLISQ NIDLQDRLNS VTDINSLRSL IQSVEPLLTG AALIPLEQAT        60
     RPPKILVDSG HTSQKIPWRL LRCTGGPLVL QLICMNSNFA IWIESC                      106
//

If you have problems or comments...

PBIL Back to PBIL home page