(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE496

CP000435.PE496       Location/Qualifiers
FT   CDS             494793..495101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0508"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47897"
FT                   /db_xref="InterPro:IPR012903"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICT7"
FT                   /protein_id="ABI47897.1"
FT                   /translation="MLNSSSSEIIQQFIHSVVQSHEIATGLKKLTSHEQIVDYASSKGF
FT                   SFTKAEWDEFVRLDSESLSSQAKQASHFHETNHWSWAFRQVSSWRAMLMEGADQGSS"
     MLNSSSSEII QQFIHSVVQS HEIATGLKKL TSHEQIVDYA SSKGFSFTKA EWDEFVRLDS        60
     ESLSSQAKQA SHFHETNHWS WAFRQVSSWR AMLMEGADQG SS                          102
//

If you have problems or comments...

PBIL Back to PBIL home page