(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE498

CP000435.PE498       Location/Qualifiers
FT   CDS             complement(496306..496845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0510"
FT                   /product="phycoerythrin linker protein CpeS"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45963"
FT                   /db_xref="GOA:Q0ICT5"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR018536"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICT5"
FT                   /protein_id="ABI45963.1"
FT                   /translation="MNIEQFVAQTEGEWRSMRSAHSLAFQQFEDVLSEISVERIDKSDS
FT                   DLQAILKQEGDLSVSDIESPFLMKWAAESDWEPDDPNDVASGQCIIVPIPNNQQSGVLL
FT                   RSVGYAESIAAKSEYNFLDDGTFVLKTRYDQSIAEERIWFVSENVRCRSSVLKTSEGSG
FT                   ILQTSFSSEVRRLVKS"
     MNIEQFVAQT EGEWRSMRSA HSLAFQQFED VLSEISVERI DKSDSDLQAI LKQEGDLSVS        60
     DIESPFLMKW AAESDWEPDD PNDVASGQCI IVPIPNNQQS GVLLRSVGYA ESIAAKSEYN       120
     FLDDGTFVLK TRYDQSIAEE RIWFVSENVR CRSSVLKTSE GSGILQTSFS SEVRRLVKS        179
//

If you have problems or comments...

PBIL Back to PBIL home page