(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE500

CP000435.PE500       Location/Qualifiers
FT   CDS             complement(497929..499437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0512"
FT                   /product="phycobilisome linker polypeptide"
FT                   /note="identified by similarity to SP:P11398; match to
FT                   protein family HMM PF00427; match to protein family HMM
FT                   PF01383"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45417"
FT                   /db_xref="GOA:Q0ICT3"
FT                   /db_xref="InterPro:IPR001297"
FT                   /db_xref="InterPro:IPR008213"
FT                   /db_xref="InterPro:IPR038255"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICT3"
FT                   /protein_id="ABI45417.1"
FT                   /translation="MAIGVGPRSHADCPHRVTSECYSPDDNSSLDDVIAAAYRQVFGNA
FT                   HVMDFERSKELEAQLRNGELTVRDFVRGLAKSSFYKQRFFTAVGPQRGIDLNIKHLLGR
FT                   APHSQAEISAKISLQAEHGQEAVIDSIVDSAEYLEVFGSDVVPYARAWSSPADLATSAF
FT                   PLLAAIQKSFAGSDSARGGSSNLISSYASGHAPRINVPSESIGVKPTPSYAAGRFASRA
FT                   PGVTSGKDGAPMRGDSYVFFGLGQREQETFQRCPGDSNDQLNALIRASYKQVMGNPHLM
FT                   EFERAISAESKYVDGYLSTREFVRALGLSAEYKRRFFETNAPYRFIELNFKHFLGRAPK
FT                   SQAEISEHTKILAESGYEAEICSYVDSVEYQTIFGEDTVPFARILSENGRSQIAFNRHL
FT                   KLAEGYAASDTVQTGSSLVTSVATDTVPGGWSSTTTRINRTGTQSGAADPTKKRFRIVV
FT                   SAQAARSRQRTAGNTYLVSGKDMSSQMKYIHSRGGKILSITEVM"
     MAIGVGPRSH ADCPHRVTSE CYSPDDNSSL DDVIAAAYRQ VFGNAHVMDF ERSKELEAQL        60
     RNGELTVRDF VRGLAKSSFY KQRFFTAVGP QRGIDLNIKH LLGRAPHSQA EISAKISLQA       120
     EHGQEAVIDS IVDSAEYLEV FGSDVVPYAR AWSSPADLAT SAFPLLAAIQ KSFAGSDSAR       180
     GGSSNLISSY ASGHAPRINV PSESIGVKPT PSYAAGRFAS RAPGVTSGKD GAPMRGDSYV       240
     FFGLGQREQE TFQRCPGDSN DQLNALIRAS YKQVMGNPHL MEFERAISAE SKYVDGYLST       300
     REFVRALGLS AEYKRRFFET NAPYRFIELN FKHFLGRAPK SQAEISEHTK ILAESGYEAE       360
     ICSYVDSVEY QTIFGEDTVP FARILSENGR SQIAFNRHLK LAEGYAASDT VQTGSSLVTS       420
     VATDTVPGGW SSTTTRINRT GTQSGAADPT KKRFRIVVSA QAARSRQRTA GNTYLVSGKD       480
     MSSQMKYIHS RGGKILSITE VM                                                502
//

If you have problems or comments...

PBIL Back to PBIL home page