(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE503

CP000435.PE503       Location/Qualifiers
FT   CDS             complement(501372..502130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0515"
FT                   /product="possible phycobilisome rod-core linker
FT                   polypeptide (L-RC 28.5)"
FT                   /note="identified by match to protein family HMM PF00427"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47163"
FT                   /db_xref="GOA:Q0ICT0"
FT                   /db_xref="InterPro:IPR001297"
FT                   /db_xref="InterPro:IPR038255"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICT0"
FT                   /protein_id="ABI47163.1"
FT                   /translation="MAIPVRNYSLKSQNSRVNNLAGNNDSIKYQVTGETSASSIAARRD
FT                   VDSLIEQTYKQIFFHAMSCDRDIYLESQLRSGYITMRDFIRGLLLSERFQQGYYQCSSN
FT                   YRMVEQVVGRVLGRSVSGEGERLAWSIVIAEKGFANFVDQILESDEYMSNFGYDGTPAQ
FT                   RGRLIPGRPSGDMPIYQRFPRYGEEWRNSLISREVVNKTFTTGGVKSEMNSIVGKPPAW
FT                   LIKSWLVLFAIGGFEISRVIITIGISMVRN"
     MAIPVRNYSL KSQNSRVNNL AGNNDSIKYQ VTGETSASSI AARRDVDSLI EQTYKQIFFH        60
     AMSCDRDIYL ESQLRSGYIT MRDFIRGLLL SERFQQGYYQ CSSNYRMVEQ VVGRVLGRSV       120
     SGEGERLAWS IVIAEKGFAN FVDQILESDE YMSNFGYDGT PAQRGRLIPG RPSGDMPIYQ       180
     RFPRYGEEWR NSLISREVVN KTFTTGGVKS EMNSIVGKPP AWLIKSWLVL FAIGGFEISR       240
     VIITIGISMV RN                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page