(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE506

CP000435.PE506       Location/Qualifiers
FT   CDS             complement(503983..504435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0518"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45316"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICS7"
FT                   /protein_id="ABI45316.1"
FT                   /translation="MESTVEQTLSNLLKNSSEEKEVHYNIGNEILRLNLKPEDIMLWRE
FT                   TLKNISNPGNVLLACESNQVDLSTTKLTWIVGAAIRSTKIGKTSEIANLLKSLDIPNDI
FT                   AEAVCKYCPGLGSEVTWAFYLERHGWLTASPIIDIKQLGNWQKDGK"
     MESTVEQTLS NLLKNSSEEK EVHYNIGNEI LRLNLKPEDI MLWRETLKNI SNPGNVLLAC        60
     ESNQVDLSTT KLTWIVGAAI RSTKIGKTSE IANLLKSLDI PNDIAEAVCK YCPGLGSEVT       120
     WAFYLERHGW LTASPIIDIK QLGNWQKDGK                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page