(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE508

CP000435.PE508       Location/Qualifiers
FT   CDS             complement(505458..505784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0520"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45197"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICS5"
FT                   /protein_id="ABI45197.1"
FT                   /translation="MLRVANCRKASRSNLDSEIYIQNPMIRVPIDDDRTFNNPDGFAMV
FT                   FDRTWKQSANAEEFAELSIDQRIDTVIKKMDDHPFLKTEPEQARQIAIFRVRLLNLDGS
FT                   NQSG"
     MLRVANCRKA SRSNLDSEIY IQNPMIRVPI DDDRTFNNPD GFAMVFDRTW KQSANAEEFA        60
     ELSIDQRIDT VIKKMDDHPF LKTEPEQARQ IAIFRVRLLN LDGSNQSG                    108
//

If you have problems or comments...

PBIL Back to PBIL home page