(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE513

CP000435.PE513       Location/Qualifiers
FT   CDS             complement(509228..509515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0526"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAE08505.1"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46387"
FT                   /db_xref="InterPro:IPR019595"
FT                   /db_xref="InterPro:IPR037119"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICS0"
FT                   /protein_id="ABI46387.1"
FT                   /translation="MTADPLTPAVSERICRHMNDDHGDAVLQFALHYGGVSAANIATMT
FT                   AVNADAMSLEVDGKPLRIPFDHTLTDSEDAHRTMVAMLRAMPSDGSKGES"
     MTADPLTPAV SERICRHMND DHGDAVLQFA LHYGGVSAAN IATMTAVNAD AMSLEVDGKP        60
     LRIPFDHTLT DSEDAHRTMV AMLRAMPSDG SKGES                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page