(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE514

CP000435.PE514       Location/Qualifiers
FT   CDS             complement(509549..509662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0527"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45577"
FT                   /db_xref="GOA:Q0ICR9"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICR9"
FT                   /protein_id="ABI45577.1"
FT                   /translation="MPNRLRDGLALGLFIVLAGYVGFSGFRLAILLWQRFS"
     MPNRLRDGLA LGLFIVLAGY VGFSGFRLAI LLWQRFS                                 37
//

If you have problems or comments...

PBIL Back to PBIL home page