(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE526

CP000435.PE526       Location/Qualifiers
FT   CDS             518855..519961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0539"
FT                   /product="putative DNA protecting protein DprA"
FT                   /note="identified by match to protein family HMM PF02481"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45303"
FT                   /db_xref="GOA:Q0ICQ7"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICQ7"
FT                   /protein_id="ABI45303.1"
FT                   /translation="MLGERGWWWLWISCPGLGVARIRALRAVANAHQVTLADLWSWPLV
FT                   RLQGALRWPDSLMARVESYRLSKGALPSLLVPDNALFPLDLDWPIAFDSLQRPPLAVHW
FT                   SGQKACWPFLSAQKAVAVVGTRRPSDHGCRMAHALGQCLARAGWPVVSGLAEGIDAASH
FT                   HGCLAASGLPVGVLGTPLDRVYPPEHEALQAQVESAGLLLSEWPRGARVQRSNFALRNR
FT                   LLVSVSCALVVVECPETSGSLLSAQIAHTQDCPVWVVPGDALRWSCKGSNGLLQEGATP
FT                   LLSPESLIAALGPGPLAAARTASMTLDRSRFSVDRNHSLLRGVDQGLTLEQLSAALSCS
FT                   PTQLAHELLQLELAGVIEPKPGLRWRSV"
     MLGERGWWWL WISCPGLGVA RIRALRAVAN AHQVTLADLW SWPLVRLQGA LRWPDSLMAR        60
     VESYRLSKGA LPSLLVPDNA LFPLDLDWPI AFDSLQRPPL AVHWSGQKAC WPFLSAQKAV       120
     AVVGTRRPSD HGCRMAHALG QCLARAGWPV VSGLAEGIDA ASHHGCLAAS GLPVGVLGTP       180
     LDRVYPPEHE ALQAQVESAG LLLSEWPRGA RVQRSNFALR NRLLVSVSCA LVVVECPETS       240
     GSLLSAQIAH TQDCPVWVVP GDALRWSCKG SNGLLQEGAT PLLSPESLIA ALGPGPLAAA       300
     RTASMTLDRS RFSVDRNHSL LRGVDQGLTL EQLSAALSCS PTQLAHELLQ LELAGVIEPK       360
     PGLRWRSV                                                                368
//

If you have problems or comments...

PBIL Back to PBIL home page