(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE528

CP000435.PE528       Location/Qualifiers
FT   CDS             520888..521505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0541"
FT                   /product="yrdC domain, putative"
FT                   /note="identified by match to protein family HMM PF01300"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46566"
FT                   /db_xref="GOA:Q0ICQ5"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICQ5"
FT                   /protein_id="ABI46566.1"
FT                   /translation="MTINPLNLFDRDRTEAHLRAGGAALLPTDTLPALASMPEQAAQIW
FT                   RLKKRPQDKPLILMGADVDALLCHVSPVARADASALAQRHWPGALTLVLPAFGPCAETL
FT                   NPGCATLGLRIPACKPMLDLLRCSGPLATTSANLSGEPASRTETEAAGAFPDLPLLAPI
FT                   PWPAPSCQASSVIAWRGPQDWHCLRRGAVMPVGVVSLPECSG"
     MTINPLNLFD RDRTEAHLRA GGAALLPTDT LPALASMPEQ AAQIWRLKKR PQDKPLILMG        60
     ADVDALLCHV SPVARADASA LAQRHWPGAL TLVLPAFGPC AETLNPGCAT LGLRIPACKP       120
     MLDLLRCSGP LATTSANLSG EPASRTETEA AGAFPDLPLL APIPWPAPSC QASSVIAWRG       180
     PQDWHCLRRG AVMPVGVVSL PECSG                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page