(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE529

CP000435.PE529       Location/Qualifiers
FT   CDS             complement(521766..522035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0543"
FT                   /product="possible transcriptional regulator, luxR family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45557"
FT                   /db_xref="GOA:Q0ICQ4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICQ4"
FT                   /protein_id="ABI45557.1"
FT                   /translation="MVLEASPDLMAEQGFTPAETAVVQLLLEGLSNRAIASRLVVSIRT
FT                   VESHISNALDKSGCRSRLELSMWWLRNHSESTRTRSVKLPTMPA"
     MVLEASPDLM AEQGFTPAET AVVQLLLEGL SNRAIASRLV VSIRTVESHI SNALDKSGCR        60
     SRLELSMWWL RNHSESTRTR SVKLPTMPA                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page