(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE533

CP000435.PE533       Location/Qualifiers
FT   CDS             complement(523916..525172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0547"
FT                   /product="HD domain protein"
FT                   /note="identified by match to protein family HMM PF01966"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47898"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICQ0"
FT                   /protein_id="ABI47898.1"
FT                   /translation="MSSRTYHDPLHGGIALNTDDPAEALVLELVDAAPFQRLRRIRQLG
FT                   PAFLTFHGAESSRFTHSLGVFHIARQAFQSLLAMDPSLELHRGVLYAAALLHDLGHAPL
FT                   SHTGEEMFGTHHEHWSARIVREHPAIQEPLERFQPGSSEAVAALLEHGSTQRRVIKDLV
FT                   SSQLDCDRLDYLLRDSYSTGTSYGQLDLERILAALTLAPDGELAIHPKGLMAVEHYLVV
FT                   RNLMYRSVYNHRLNVVCNWLLEQMIRLARELGPNDVWTDSTMHSWLWSAHELDLESYLA
FT                   NDDLRTGYHLLRWREEAPRPLADLCDRFLNRRLFKALDVDSLSKEKQLECLAQARGLAE
FT                   AKGLDPSLCCGLRHQQLRGYHPYRGGLRLWNGQQLQALEQSSALVRSLSTPASTSWLIY
FT                   PKQIGQELKRKVGQYLAHI"
     MSSRTYHDPL HGGIALNTDD PAEALVLELV DAAPFQRLRR IRQLGPAFLT FHGAESSRFT        60
     HSLGVFHIAR QAFQSLLAMD PSLELHRGVL YAAALLHDLG HAPLSHTGEE MFGTHHEHWS       120
     ARIVREHPAI QEPLERFQPG SSEAVAALLE HGSTQRRVIK DLVSSQLDCD RLDYLLRDSY       180
     STGTSYGQLD LERILAALTL APDGELAIHP KGLMAVEHYL VVRNLMYRSV YNHRLNVVCN       240
     WLLEQMIRLA RELGPNDVWT DSTMHSWLWS AHELDLESYL ANDDLRTGYH LLRWREEAPR       300
     PLADLCDRFL NRRLFKALDV DSLSKEKQLE CLAQARGLAE AKGLDPSLCC GLRHQQLRGY       360
     HPYRGGLRLW NGQQLQALEQ SSALVRSLST PASTSWLIYP KQIGQELKRK VGQYLAHI         418
//

If you have problems or comments...

PBIL Back to PBIL home page