(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE534

CP000435.PE534       Location/Qualifiers
FT   CDS             complement(525169..526467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0548"
FT                   /product="carboxyl-terminal processing proteinase"
FT                   /EC_number="3.4.21.102"
FT                   /note="identified by match to protein family HMM PF00595;
FT                   match to protein family HMM PF03572; match to protein
FT                   family HMM TIGR00225"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47092"
FT                   /db_xref="GOA:Q0ICP9"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICP9"
FT                   /protein_id="ABI47092.1"
FT                   /translation="MLPIVNYMRKGLRQLASGLASLLLCSLLIPAPALALNDAQQLVVE
FT                   TWRLVNQSYVDPSTFDRIHWKRLRQKALEKTIETSEQAYSAIEAMLEPLDDPYTRLLRP
FT                   DDYSVMKSSNSGSLSGVGLQLGHHNDEDSVVVIAALEGSPAADAGVVSGAALLAVNGES
FT                   TALLGLETTAARLRGDVGTQVLLTVQPPNGEPEELTLERRNVDLRPVRTRRLRSDTHTL
FT                   GHLRITQFSEGVPNQVQEALQELTDKGVEGVVLDLRNNSGGLVSGGLAVADAFLNQEPI
FT                   VETRNRDGIADPIQSNPITLYDGPMVTLVNAGTASASEILAGALQDNDRSLLLGSETFG
FT                   KGLIQTLTNLSDGSGLAVTVAGYVTPSGRDIQGQGITPDRLLDQPEPLNPGGEGDRWLT
FT                   DAARVLEAIIDRQTAESPPTTDLSNEEEMAATA"
     MLPIVNYMRK GLRQLASGLA SLLLCSLLIP APALALNDAQ QLVVETWRLV NQSYVDPSTF        60
     DRIHWKRLRQ KALEKTIETS EQAYSAIEAM LEPLDDPYTR LLRPDDYSVM KSSNSGSLSG       120
     VGLQLGHHND EDSVVVIAAL EGSPAADAGV VSGAALLAVN GESTALLGLE TTAARLRGDV       180
     GTQVLLTVQP PNGEPEELTL ERRNVDLRPV RTRRLRSDTH TLGHLRITQF SEGVPNQVQE       240
     ALQELTDKGV EGVVLDLRNN SGGLVSGGLA VADAFLNQEP IVETRNRDGI ADPIQSNPIT       300
     LYDGPMVTLV NAGTASASEI LAGALQDNDR SLLLGSETFG KGLIQTLTNL SDGSGLAVTV       360
     AGYVTPSGRD IQGQGITPDR LLDQPEPLNP GGEGDRWLTD AARVLEAIID RQTAESPPTT       420
     DLSNEEEMAA TA                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page