(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE54

CP000435.PE54        Location/Qualifiers
FT   CDS             complement(57488..58357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0055"
FT                   /product="thiamin biosynthesis protein"
FT                   /EC_number="1.5.3.-"
FT                   /note="identified by match to protein family HMM PF05690"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46968"
FT                   /db_xref="GOA:Q0IE29"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE29"
FT                   /protein_id="ABI46968.1"
FT                   /translation="MRPAWTPSRSGSPTKPQLTTMDPTHSHDDALQIGGRTFNSRLITG
FT                   TGKYPSLEAMQHSLQRSGCEMVTVAVRRVQAVAEGHAGLMEAIDWSQIWMLPNTAGCTN
FT                   AEEAVRVARLGRELAKLAGQDNNFVKLEVIPDSRHLLPDPFGTLEAAEMLVKEGFTVLP
FT                   YINADPLLAKRLEDVGCATVMPLGSPIGSGQGLRNAANIGLIIENAKVPVVVDAGIGVP
FT                   SDAAQAMEMGADAVLINSAIALSGQPPLMAEAMANAVNAGRQSLRAGRLPTRPEASPSS
FT                   PTSGRING"
     MRPAWTPSRS GSPTKPQLTT MDPTHSHDDA LQIGGRTFNS RLITGTGKYP SLEAMQHSLQ        60
     RSGCEMVTVA VRRVQAVAEG HAGLMEAIDW SQIWMLPNTA GCTNAEEAVR VARLGRELAK       120
     LAGQDNNFVK LEVIPDSRHL LPDPFGTLEA AEMLVKEGFT VLPYINADPL LAKRLEDVGC       180
     ATVMPLGSPI GSGQGLRNAA NIGLIIENAK VPVVVDAGIG VPSDAAQAME MGADAVLINS       240
     AIALSGQPPL MAEAMANAVN AGRQSLRAGR LPTRPEASPS SPTSGRING                   289
//

If you have problems or comments...

PBIL Back to PBIL home page