(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE544

CP000435.PE544       Location/Qualifiers
FT   CDS             538310..539347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0563"
FT                   /product="Uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45350"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICN9"
FT                   /protein_id="ABI45350.1"
FT                   /translation="MTSLSSEAPTFNLDLPDPERDDISTMEFLARLEQAWDVCDKFDLQ
FT                   TEIWRGRILKSVRDREKRGGEGRGAGFLQWLREREISKTRAYGLIQLAESEQGLVGEGL
FT                   LEQSSVNQFSKRAFLETALAAPEVQVMIAEAANEGQEITRKQVRRLTDDFTSATSPLLP
FT                   DEIRQRAQENLLPSKVVAPLVRELSKLPEVQQEDFRKVLRDEPELDRIKDVTHTARWIT
FT                   KATESGVAVRAFQQGELDLEKAMQEAQRLDALGLLADAVGQAQALESAVLKLHTSWRRL
FT                   GGLHERLWVESGSSTPYLRDVLTALQTLSGATMRVSLGELAGGKRVRLQLVEEAPDQLE
FT                   PPITL"
     MTSLSSEAPT FNLDLPDPER DDISTMEFLA RLEQAWDVCD KFDLQTEIWR GRILKSVRDR        60
     EKRGGEGRGA GFLQWLRERE ISKTRAYGLI QLAESEQGLV GEGLLEQSSV NQFSKRAFLE       120
     TALAAPEVQV MIAEAANEGQ EITRKQVRRL TDDFTSATSP LLPDEIRQRA QENLLPSKVV       180
     APLVRELSKL PEVQQEDFRK VLRDEPELDR IKDVTHTARW ITKATESGVA VRAFQQGELD       240
     LEKAMQEAQR LDALGLLADA VGQAQALESA VLKLHTSWRR LGGLHERLWV ESGSSTPYLR       300
     DVLTALQTLS GATMRVSLGE LAGGKRVRLQ LVEEAPDQLE PPITL                       345
//

If you have problems or comments...

PBIL Back to PBIL home page