(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE546

CP000435.PE546       Location/Qualifiers
FT   CDS             complement(540890..541954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0565"
FT                   /product="possible LysM domain"
FT                   /note="identified by match to protein family HMM PF01476"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46528"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICN7"
FT                   /protein_id="ABI46528.1"
FT                   /translation="MGKTPYLSPSTERSMRSIVAAALTLSALMPLQAGAASITVKPGDT
FT                   ISGLADRYGVSVKSLMKANGIRNSNHVEVGQTLRLPSGARGVVSAGQGRHIVQGGDTLG
FT                   GIAARYRVSERDLIAINNLPSADHVEVGQTLKLPTSALLPKPKSVAKAKPTPIKANPNA
FT                   TSHTVARGQTLTQIARAYEVPVASLIDLNTINDPNRVTIGTKLMLRDIRRSETTESVST
FT                   AVPTSTTPVVKPVLTATASQSTKTVQVKPVQSTTTPTKAAPAKTTTTPSVEAKPAAWRT
FT                   YGPLQVDWSNWQSMGGSMVAPTLNSEGKPLYVAVNCSARKINVTSSDGAWKSWIAPQTN
FT                   FEKDLVKDRCNKTA"
     MGKTPYLSPS TERSMRSIVA AALTLSALMP LQAGAASITV KPGDTISGLA DRYGVSVKSL        60
     MKANGIRNSN HVEVGQTLRL PSGARGVVSA GQGRHIVQGG DTLGGIAARY RVSERDLIAI       120
     NNLPSADHVE VGQTLKLPTS ALLPKPKSVA KAKPTPIKAN PNATSHTVAR GQTLTQIARA       180
     YEVPVASLID LNTINDPNRV TIGTKLMLRD IRRSETTESV STAVPTSTTP VVKPVLTATA       240
     SQSTKTVQVK PVQSTTTPTK AAPAKTTTTP SVEAKPAAWR TYGPLQVDWS NWQSMGGSMV       300
     APTLNSEGKP LYVAVNCSAR KINVTSSDGA WKSWIAPQTN FEKDLVKDRC NKTA             354
//

If you have problems or comments...

PBIL Back to PBIL home page