(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE548

CP000435.PE548       Location/Qualifiers
FT   CDS             543480..545234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0567"
FT                   /product="trehalose synthase"
FT                   /EC_number="5.4.99.16"
FT                   /note="identified by match to protein family HMM PF00128"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45419"
FT                   /db_xref="GOA:Q0ICN5"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICN5"
FT                   /protein_id="ABI45419.1"
FT                   /translation="MTSRPIGVSTSWNGAGVMTKQQPWWNGAVIYQLIVRSYADGNGDG
FT                   IGDLQGLANRLPYLRWLGVEAIWLTPIYPSPLQDGGYDITDFKSIHPELGDLAAFHRVL
FT                   IAAHSHGIKVVMDLVLNHTSTLHPWFQRARWAPEGSPERDVYVWSDDPKRYADAPVLFR
FT                   HFESSNWEWDEVAQQYYLHRFLRHQPDLNYDSPVVQEEMLDVVDFWIERGVDGFRLDAV
FT                   PFLCEAEGSRCEGLPETHEFLKRLRARVDRHGKDVLLLAEAIQPVEEAAPYLADDELHG
FT                   AFNFALTAHLFASIASGTVEALRECLQAAQNAVGGCRWALPLRNHDELWLGDGHLVPEE
FT                   VIQTIRAGLHQGQGHWLNWGINRRLAPLLNGDPGSNRVMHALLYSLPGLPCLYYGDELG
FT                   MGDWPGLRDRDPNRTPMAWTPGRNGGFSTAPDPLLVLPPITAPGYDYRVVNVEVQKQLP
FT                   GSLLNWHRRMLTCRKLLPALRNGDFELLDCAHPGVIVYVRTNATMTVLVAANLSAAGAS
FT                   FRLDLSRWAGERTREVLWGCDFPPADADWFVYLAAHGFSWWLIGEVEETDNTSEDIDAQ
FT                   QDKLSSGV"
     MTSRPIGVST SWNGAGVMTK QQPWWNGAVI YQLIVRSYAD GNGDGIGDLQ GLANRLPYLR        60
     WLGVEAIWLT PIYPSPLQDG GYDITDFKSI HPELGDLAAF HRVLIAAHSH GIKVVMDLVL       120
     NHTSTLHPWF QRARWAPEGS PERDVYVWSD DPKRYADAPV LFRHFESSNW EWDEVAQQYY       180
     LHRFLRHQPD LNYDSPVVQE EMLDVVDFWI ERGVDGFRLD AVPFLCEAEG SRCEGLPETH       240
     EFLKRLRARV DRHGKDVLLL AEAIQPVEEA APYLADDELH GAFNFALTAH LFASIASGTV       300
     EALRECLQAA QNAVGGCRWA LPLRNHDELW LGDGHLVPEE VIQTIRAGLH QGQGHWLNWG       360
     INRRLAPLLN GDPGSNRVMH ALLYSLPGLP CLYYGDELGM GDWPGLRDRD PNRTPMAWTP       420
     GRNGGFSTAP DPLLVLPPIT APGYDYRVVN VEVQKQLPGS LLNWHRRMLT CRKLLPALRN       480
     GDFELLDCAH PGVIVYVRTN ATMTVLVAAN LSAAGASFRL DLSRWAGERT REVLWGCDFP       540
     PADADWFVYL AAHGFSWWLI GEVEETDNTS EDIDAQQDKL SSGV                        584
//

If you have problems or comments...

PBIL Back to PBIL home page