(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE555

CP000435.PE555       Location/Qualifiers
FT   CDS             complement(553215..553784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0574"
FT                   /product="Two-component response regulator, CheY-like
FT                   receiver and wHTH DNA-binding domains"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47723"
FT                   /db_xref="GOA:Q0ICM8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICM8"
FT                   /protein_id="ABI47723.1"
FT                   /translation="MNCLVLEDQQIFLDLLGSMVKSFTEISAVFKANSIESAREISSQQ
FT                   TIDLAILDIYLPDGLCNDLAQHLALQNPDIKIIILSGAAQEFVCPEGLKEAIYGIVDKT
FT                   DAFDALRHCINVIVKPAHQDLTERQQTIYNLIGEGKTTKEIAKKLGSAHSTIETHRKAI
FT                   ALKLNVSGAELIRRAALTRTIQSIDQ"
     MNCLVLEDQQ IFLDLLGSMV KSFTEISAVF KANSIESARE ISSQQTIDLA ILDIYLPDGL        60
     CNDLAQHLAL QNPDIKIIIL SGAAQEFVCP EGLKEAIYGI VDKTDAFDAL RHCINVIVKP       120
     AHQDLTERQQ TIYNLIGEGK TTKEIAKKLG SAHSTIETHR KAIALKLNVS GAELIRRAAL       180
     TRTIQSIDQ                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page