(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE565

CP000435.PE565       Location/Qualifiers
FT   CDS             complement(557650..558438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0586"
FT                   /product="possible DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47284"
FT                   /db_xref="GOA:Q0ICL8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICL8"
FT                   /protein_id="ABI47284.1"
FT                   /translation="MVHKYQIVTIGKRTIRRYHHSSIHRQKQLRLNPSEGALKKAVDAC
FT                   KQMLANKRVLVCSKNRLTLTAVSLAEPILQSLIGGTTTEDEALEIQLESNPDLLITSED
FT                   LERGYGIRLVEKAKRQSPDIKALIFLSRETPEVVQEAMEAGADGVMFVSSMGTGDGDFI
FT                   NALRTTNNGGIYYPRAVLEAATANVKPAPILVDPLSERELEVIQCIICGMKNTEIADSL
FT                   LVSAETVKSHVSTVIHKLGVRDRTQAAVFALTHGLVEAHI"
     MVHKYQIVTI GKRTIRRYHH SSIHRQKQLR LNPSEGALKK AVDACKQMLA NKRVLVCSKN        60
     RLTLTAVSLA EPILQSLIGG TTTEDEALEI QLESNPDLLI TSEDLERGYG IRLVEKAKRQ       120
     SPDIKALIFL SRETPEVVQE AMEAGADGVM FVSSMGTGDG DFINALRTTN NGGIYYPRAV       180
     LEAATANVKP APILVDPLSE RELEVIQCII CGMKNTEIAD SLLVSAETVK SHVSTVIHKL       240
     GVRDRTQAAV FALTHGLVEA HI                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page