(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE567

CP000435.PE567       Location/Qualifiers
FT   CDS             complement(558871..559014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0588"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47408"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICL6"
FT                   /protein_id="ABI47408.1"
FT                   /translation="MIFSFEIKRSVHSLPLQMEWDKVTSRHIRPIIGDAINQQVNFERV
FT                   LI"
     MIFSFEIKRS VHSLPLQMEW DKVTSRHIRP IIGDAINQQV NFERVLI                      47
//

If you have problems or comments...

PBIL Back to PBIL home page