(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE578

CP000435.PE578       Location/Qualifiers
FT   CDS             568407..569081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0599"
FT                   /product="conserved hypothetical protein TIGR00044"
FT                   /note="identified by match to protein family HMM PF01168;
FT                   match to protein family HMM TIGR00044"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45157"
FT                   /db_xref="GOA:Q0ICK5"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICK5"
FT                   /protein_id="ABI45157.1"
FT                   /translation="MASSSSESETIQSRWQAIHAECPDSVNLLAVSKGHPAMAVRELAA
FT                   LGQVDFGESRVQEALPKQQDLEDLSSLRWHFIGRLQANKVRAVVRAFPVIHSIDSQGLA
FT                   ERTSRIAVEENRIPEVFFQVKLREDPAKGGWEPDALREVWPQLQSLPGLKPIGLMTMAP
FT                   LGLGLEDRQSLFHDCRTLADELALSECSMGMSGDWKQAAKAGATWVRVGSGLFGPRPER
FT                   LV"
     MASSSSESET IQSRWQAIHA ECPDSVNLLA VSKGHPAMAV RELAALGQVD FGESRVQEAL        60
     PKQQDLEDLS SLRWHFIGRL QANKVRAVVR AFPVIHSIDS QGLAERTSRI AVEENRIPEV       120
     FFQVKLREDP AKGGWEPDAL REVWPQLQSL PGLKPIGLMT MAPLGLGLED RQSLFHDCRT       180
     LADELALSEC SMGMSGDWKQ AAKAGATWVR VGSGLFGPRP ERLV                        224
//

If you have problems or comments...

PBIL Back to PBIL home page