(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE593

CP000435.PE593       Location/Qualifiers
FT   CDS             complement(584836..585639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0614"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45365"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICJ0"
FT                   /protein_id="ABI45365.1"
FT                   /translation="MKKLIGLLGAAGLLIPSAAMAGNIGNQTGSSAMRATGTSSSYTEV
FT                   SVDSNIHRNNHIYVAGYNHGVSVDFSAENATFGHRGGGYGYDQTTGNAAANIDAEVEGG
FT                   YGRVSRHAAEGYIDGEAEGDVTVTTEYTPGQEAKDGFLCGRRGCIVPPQEATPEITAVN
FT                   TEGDVAFAGEAGGERSSLHGHGGYAEAEGYLNGGYDDSNIVFEGGGSEHFLNGAASGSI
FT                   DNYGNGYLGSLTETGDTHTSVDAWTSATSTSRGFESSSFTNTDWN"
     MKKLIGLLGA AGLLIPSAAM AGNIGNQTGS SAMRATGTSS SYTEVSVDSN IHRNNHIYVA        60
     GYNHGVSVDF SAENATFGHR GGGYGYDQTT GNAAANIDAE VEGGYGRVSR HAAEGYIDGE       120
     AEGDVTVTTE YTPGQEAKDG FLCGRRGCIV PPQEATPEIT AVNTEGDVAF AGEAGGERSS       180
     LHGHGGYAEA EGYLNGGYDD SNIVFEGGGS EHFLNGAASG SIDNYGNGYL GSLTETGDTH       240
     TSVDAWTSAT STSRGFESSS FTNTDWN                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page