(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE595

CP000435.PE595       Location/Qualifiers
FT   CDS             587368..587811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0616"
FT                   /product="Uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46486"
FT                   /db_xref="InterPro:IPR021297"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICI8"
FT                   /protein_id="ABI46486.1"
FT                   /translation="MSEHSSLTIKRSITIRAVVTPAWKEEAERELSNGIATTDQQLSQL
FT                   EQEGQEVVDQVRRQSANPLDPRVQDQVAQVQQQVAAKRSELEEQKRNLLQQQAQVRELE
FT                   MDQIVEQGQLDSFCDIQVGDNLVSKMQVSVVVRDGVIESIEQG"
     MSEHSSLTIK RSITIRAVVT PAWKEEAERE LSNGIATTDQ QLSQLEQEGQ EVVDQVRRQS        60
     ANPLDPRVQD QVAQVQQQVA AKRSELEEQK RNLLQQQAQV RELEMDQIVE QGQLDSFCDI       120
     QVGDNLVSKM QVSVVVRDGV IESIEQG                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page