(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE596

CP000435.PE596       Location/Qualifiers
FT   CDS             588039..589172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0617"
FT                   /product="2-oxo acid dehydrogenases acyltransferase
FT                   (catalytic domain) protein"
FT                   /note="identified by match to protein family HMM PF00198;
FT                   match to protein family HMM PF02817"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45271"
FT                   /db_xref="GOA:Q0ICI7"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICI7"
FT                   /protein_id="ABI45271.1"
FT                   /translation="MPAGSTAPVGETIGLIVETEAEIADVKAKAPSSAPAAPAAAAPPA
FT                   APAPPTPVSAPAAVSAPAPVTAPVAASVSNGRLIVSPRARKLASQMGVDLAGLRGTGPN
FT                   GRIQAEDVEKAAGRPVTPPRVGEGTSAAAVVGDTVSASPSAPSGNSFGAPGDTVAFNTL
FT                   QAAVNRNMEASLAVPCFRVGYTITTDKLDAFYKQVKLKGVTMTALLAKAVAVTLARHPQ
FT                   VNAATTASGMSYPAEVNVAVAVAMEDGGLITPVLRNADRTDLYELSRQWGDLVKRSRSK
FT                   QLQPEEYSTGTFTLSNLGMFGVDRFDAILPPGTGAILAVAASRPTVVAGKDGSIAVKRQ
FT                   MQVNLTADHRVIYGADGAAFLKDLAELIDTRPESLAL"
     MPAGSTAPVG ETIGLIVETE AEIADVKAKA PSSAPAAPAA AAPPAAPAPP TPVSAPAAVS        60
     APAPVTAPVA ASVSNGRLIV SPRARKLASQ MGVDLAGLRG TGPNGRIQAE DVEKAAGRPV       120
     TPPRVGEGTS AAAVVGDTVS ASPSAPSGNS FGAPGDTVAF NTLQAAVNRN MEASLAVPCF       180
     RVGYTITTDK LDAFYKQVKL KGVTMTALLA KAVAVTLARH PQVNAATTAS GMSYPAEVNV       240
     AVAVAMEDGG LITPVLRNAD RTDLYELSRQ WGDLVKRSRS KQLQPEEYST GTFTLSNLGM       300
     FGVDRFDAIL PPGTGAILAV AASRPTVVAG KDGSIAVKRQ MQVNLTADHR VIYGADGAAF       360
     LKDLAELIDT RPESLAL                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page