(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE597

CP000435.PE597       Location/Qualifiers
FT   CDS             589182..591104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0618"
FT                   /product="Amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45859"
FT                   /db_xref="GOA:Q0ICI6"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICI6"
FT                   /protein_id="ABI45859.1"
FT                   /translation="MFAASLFSRLIGRALPRAQAARERLPNLQALPILSSDALSSVAYA
FT                   TEASLGVLILAGSSALKQSLPITLAIIALIVIVVLSYRQAISAYPNGGGSYVVARENLG
FT                   RNISLVAAAALLIDYTLTAAVSLMAGTQALSSLLPSLLPHELSLSLLLLALVGWANLRG
FT                   IREAGRIFAIPTYVFVVMILLLTLVGLTDLSFQHGWTPEPPPLEAALQPLGLFLILRAF
FT                   SSGCSAMTGIEAISTGVQVFREPAARNARVTLLVMGGLLASMLLAVTGLGFMYGIAPDS
FT                   QVTVLAQIGIRVFGSGSILFWLLQLSTLLILVLAANTAFAGFPLLAAMLAEDRCLPPQM
FT                   RWLGDRLVYQNGIGVLLAVSALIIWICHGDTTVAVNLYALGVFTAFTLSQLGLVLHWFR
FT                   MRGPGWQGRMALNALGALSTFVVLLVIIVSKFTEGAWSVVIALPLVVWGLALIRRRSRE
FT                   VLALLAPDPRMEPLFLEPKASLPRHHAIVWLGGFNQPSFEAVRYACSIADKVTAVMVLS
FT                   DQQDADQIGAEWDRCAGTQTGALDFQCLESPFSSLLQPFCDFVVEQERNHPELCTTVVM
FT                   PVVVPRDRLDQTLLNQRALNLFTALSAGKSRVFSIVRFYISPAGKKDNAALAACPDVVV
FT                   KPDDA"
     MFAASLFSRL IGRALPRAQA ARERLPNLQA LPILSSDALS SVAYATEASL GVLILAGSSA        60
     LKQSLPITLA IIALIVIVVL SYRQAISAYP NGGGSYVVAR ENLGRNISLV AAAALLIDYT       120
     LTAAVSLMAG TQALSSLLPS LLPHELSLSL LLLALVGWAN LRGIREAGRI FAIPTYVFVV       180
     MILLLTLVGL TDLSFQHGWT PEPPPLEAAL QPLGLFLILR AFSSGCSAMT GIEAISTGVQ       240
     VFREPAARNA RVTLLVMGGL LASMLLAVTG LGFMYGIAPD SQVTVLAQIG IRVFGSGSIL       300
     FWLLQLSTLL ILVLAANTAF AGFPLLAAML AEDRCLPPQM RWLGDRLVYQ NGIGVLLAVS       360
     ALIIWICHGD TTVAVNLYAL GVFTAFTLSQ LGLVLHWFRM RGPGWQGRMA LNALGALSTF       420
     VVLLVIIVSK FTEGAWSVVI ALPLVVWGLA LIRRRSREVL ALLAPDPRME PLFLEPKASL       480
     PRHHAIVWLG GFNQPSFEAV RYACSIADKV TAVMVLSDQQ DADQIGAEWD RCAGTQTGAL       540
     DFQCLESPFS SLLQPFCDFV VEQERNHPEL CTTVVMPVVV PRDRLDQTLL NQRALNLFTA       600
     LSAGKSRVFS IVRFYISPAG KKDNAALAAC PDVVVKPDDA                             640
//

If you have problems or comments...

PBIL Back to PBIL home page