(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE605

CP000435.PE605       Location/Qualifiers
FT   CDS             598109..598393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0626"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAE20369.1; match to
FT                   protein family HMM PF07864"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47038"
FT                   /db_xref="InterPro:IPR012447"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICH8"
FT                   /protein_id="ABI47038.1"
FT                   /translation="MLSMSMGCFADVGVEGWLTDRCGYWAMRFHRDEQSDENDPRIFVD
FT                   YGRGMPNGQSAFLKSRKHLPRKDAETQWNRLIEIGWTQVPPVWGQGIEP"
     MLSMSMGCFA DVGVEGWLTD RCGYWAMRFH RDEQSDENDP RIFVDYGRGM PNGQSAFLKS        60
     RKHLPRKDAE TQWNRLIEIG WTQVPPVWGQ GIEP                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page